missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF529 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-80121
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ZNF529 Polyclonal specifically detects ZNF529 in Human samples. It is validated for Western Blot.
Especificaciones
| ZNF529 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KIAA1615, zinc finger protein 529 | |
| Rabbit | |
| 54 kDa | |
| 100 μL | |
| Primary | |
| Porcine: 85%; Canine: 77%; Bovine: 77%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_066002 | |
| ZNF529 | |
| Synthetic peptide directed towards the N terminal of human ZNF529. Peptide sequence QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVFSCDLEFDEYQ. | |
| Affinity purified | |
| RUO | |
| 57711 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido