missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ZNF554 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Tekniske data
| Antigen | ZNF554 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18251444
|
Novus Biologicals
NBP2-55914 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687326
|
Novus Biologicals
NBP2-55914-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
ZNF554 Polyclonal specifically detects ZNF554 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Tekniske data
| ZNF554 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ34817, zinc finger protein 554 | |
| ZNF554 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 115196 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel