missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF75A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | ZNF75A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF75A Polyclonal specifically detects ZNF75A in Human samples. It is validated for Western Blot.Specifications
| ZNF75A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ31529, MGC59959, zinc finger protein 75a | |
| ZNF75A | |
| IgG | |
| 35 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_694573 | |
| 7627 | |
| Synthetic peptide directed towards the N terminal of human ZNF75A. Peptide sequence FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title