missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF879 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 484.00
Specifications
| Antigen | ZNF879 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF879 Polyclonal specifically detects ZNF879 in Human samples. It is validated for Western Blot.Specifications
| ZNF879 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 345462 | |
| Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| zinc finger protein 879 | |
| ZNF879 | |
| IgG | |
| 77 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title