All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (3)
- (159)
- (188)
- (164)
- (7)
- (203)
- (117)
- (44)
- (165)
- (52)
- (3)
- (2)
- (286)
- (314)
- (75)
- (6)
- (2)
- (15)
- (12)
- (13)
- (14)
- (14)
- (12)
- (12)
- (14)
- (12)
- (7)
- (12)
- (12)
- (13)
- (12)
- (10)
- (12)
- (12)
- (12)
- (9)
- (12)
- (1)
- (5)
- (1)
- (1)
- (5)
- (1)
- (6)
- (2)
- (1)
- (2)
- (5)
- (101)
- (3)
- (3)
- (3)
- (6)
- (269)
- (112)
- (2)
- (2)
- (7)
- (2)
- (263)
- (18)
- (1)
- (1)
- (46)
- (22)
- (1)
- (2)
- (7)
- (4)
- (3)
- (5)
- (2)
- (1)
- (2)
Filtered Search Results
Invitrogen™ DJ-1 Monoclonal Antibody (4H4)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ DJ-1 Monoclonal Antibody (4H4)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Bovine |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q5E946, Q99497 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | DJ-1 |
| Gene Symbols | Park7 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | CAP1; Contraception-associated protein 1; CTA-215D11.1; dj1; DJ-1; DJ-1 protein; early onset 7; epididymis secretory sperm binding protein Li 67p; fertility protein SP22; FLJ27376; FLJ34360; FLJ92274; HEL-S-67p; hypothetical protein LOC449674; maillard deglycase; Oncogene DJ1; OTTHUMP00000001350; OTTHUMP00000001351; PARK7; PARK7 GENE; PARK7/DJ1; parkinson disease (autosomal recessive, early onset) 7; Parkinson disease 7; Parkinson disease protein 7; Parkinson disease protein 7 homolog; Parkinson disease protein 7 homolog; protein/nucleic acid deglycase DJ-1; parkinson protein 7; Parkinsonism associated deglycase; parkinsonism-associated deglycase; Protein CAP1; protein deglycase DJ-1; protein deglycase DJ-1zDJ-1; Protein DJ-1; protein DJ-1-like protein; protein DJ-1zDJ-1; Protein/nucleic acid deglycase DJ-1; RNA-binding protein regulatory subunit; SP22; zDJ-1; zgc:103725 |
| Gene | Park7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11315, 511268 |
| Formulation | PBS with 50% glycerol and 5mM sodium azide |
| Immunogen | Full length recombinant human DJ1 expressed in and purified from E. coli. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 4H4 |
Invitrogen™ DJ-1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O88767, Q99497, Q99LX0 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | DJ-1 |
| Gene Symbols | Park7 |
| Regulatory Status | RUO |
| Gene Alias | CAP1; Contraception-associated protein 1; CTA-215D11.1; dj1; DJ-1; DJ-1 protein; early onset 7; epididymis secretory sperm binding protein Li 67p; fertility protein SP22; FLJ27376; FLJ34360; FLJ92274; HEL-S-67p; hypothetical protein LOC449674; maillard deglycase; Oncogene DJ1; OTTHUMP00000001350; OTTHUMP00000001351; PARK7; PARK7 GENE; PARK7/DJ1; parkinson disease (autosomal recessive, early onset) 7; Parkinson disease 7; Parkinson disease protein 7; Parkinson disease protein 7 homolog; Parkinson disease protein 7 homolog; protein/nucleic acid deglycase DJ-1; parkinson protein 7; Parkinsonism associated deglycase; parkinsonism-associated deglycase; Protein CAP1; protein deglycase DJ-1; protein deglycase DJ-1zDJ-1; Protein DJ-1; protein DJ-1-like protein; protein DJ-1zDJ-1; Protein/nucleic acid deglycase DJ-1; RNA-binding protein regulatory subunit; SP22; zDJ-1; zgc:103725 |
| Gene | Park7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11315, 117287, 57320 |
| Formulation | whole serum with 5mM sodium azide |
| Immunogen | Full length recombinant human DJ1 expressed in and purified from E. coli. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Zinc Finger |
| Antigen | MNAB |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Gene Alias | FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164 |
| Gene ID (Entrez) | 54542 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV |
| Classification | Polyclonal |
| Primary or Secondary | Primary |