Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
153,632
results
Mouse MMR/CD206 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Goat Polyclonal Antibody has been used in 44 publications
Human CD163 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Goat Polyclonal Antibody has been used in 12 publications
Human IL-6 Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Goat Polyclonal Antibody has been used in 29 publications
| Accession Number | Q9GZX6.1 |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | Cytokine Zcyto18, IL-10-related T-cell-derived inducible factor, IL22, IL-D110, IL-TIF, ILTIFIL-10-related T-cell-derived-inducible factor, IL-TIFMGC79382, interleukin 22, interleukin-22, MGC79384, TIFa, TIFIL-23, zcyto18 |
| Molecular Weight (g/mol) | M.W. Observed: 28-32 kDa, under reducing conditions., M.W. Theoretical: 17 kDa |
| Gene ID (Entrez) | 50616 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute the 10 μg size at 100 μg/mL in PBS. Reconstitute all other sizes at 500 μg/mL in PBS. |
| For Use With (Application) | Bioactivity |
| Protein | IL-22 |
| Source | Human embryonic kidney cell, HEK293-derived human IL-22 protein Ala34-Ile179 |
Human Fc gamma RIIB/C (CD32b/c) Biotinylated Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Sheep anti-Equine IgM Heavy Chain Secondary Antibody, Biotin, Novus Biologicals™
Sheep Polyclonal Antibody
Goat anti-Canine IgM Heavy Chain Secondary Antibody, Biotin, Novus Biologicals™
Goat Polyclonal Antibody
Clostridium Difficile Toxin A Antibody (PCG4.1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 18 publications
Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™
Rabbit Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer |
| Concentration | 1 mg/mL |
| Antigen | CoagulationFactorIII/TissueFactor |
| Gene Symbols | F3 |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500 |
| Gene Alias | CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor |
| Gene ID (Entrez) | 2152 |
| Formulation | TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide |
| Immunogen | Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SN20-16 |
Human IFN-beta Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody has been used in 4 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Flow Cytometry,Neutralization |
| Isotype | IgG1 |
| Gene Accession No. | P01574 |
| Antigen | IFN-beta |
| Gene Symbols | IFNB1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from ascites |
| Dilution | Western Blot 1 ug/mL, Flow Cytometry 0.25 uL/10^6 cells, Neutralization 7-21 ug/mL |
| Gene Alias | Fibroblast interferon, IFB, IFBIFNB, IFF, IFNB, IFNB1, IFNbeta, IFN-beta, interferon beta, interferon, beta 1, fibroblast, MGC96956 |
| Gene ID (Entrez) | 3456 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | E. coli-derived recombinant human IFN-beta Met22-Asn187 Accession # P01574 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human IFN-beta in Western blots. In Western blots, this antibody does not cross-react with recombinant human IFN-alpha . |
| Clone | 76703 |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Signal Transduction, Vision |
| Antigen | USH1C |
| Gene Symbols | USH1C |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein |
| Gene ID (Entrez) | 10083 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |