missing translation for 'onlineSavingsMsg'
Learn More
Learn More
A-RAF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49479
This item is not returnable.
View return policy
Description
A-RAF Polyclonal antibody specifically detects A-RAF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| A-RAF | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf, v-raf murine sarcoma 3611 viral oncogene homolog, v-raf murine sarcoma 3611 viral oncogene homolog 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTST | |
| 0.1 mL | |
| Protein Kinase, Signal Transduction | |
| 369 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction