missing translation for 'onlineSavingsMsg'
Learn More
Learn More
A-RAF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | A-RAF |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639316
|
Novus Biologicals
NBP2-49479-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643177
|
Novus Biologicals
NBP2-49479 |
0.1 mL |
€ 593.00 € 560.70 / 0.10mL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
A-RAF Polyclonal antibody specifically detects A-RAF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| A-RAF | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 369 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf, v-raf murine sarcoma 3611 viral oncogene homolog, v-raf murine sarcoma 3611 viral oncogene homolog 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTST | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title