missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14283-25ul
This item is not returnable.
View return policy
Description
ABH1 Polyclonal specifically detects ABH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ABH1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q13686 | |
| ALKBH1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABH1, ABHalkB, alkylation repair homolog (E. coli), alkB, alkB, alkylation repair homolog 1 (E. coli), ALKBH, alkylated DNA repair protein alkB homolog 1, alkylation repair, alkB homolog, Alpha-ketoglutarate-dependent dioxygenase ABH1, DNA lyase ABH1, EC 1.14.11.-, EC 4.2.99.18, hABH | |
| Rabbit | |
| 44 kDa | |
| 25ul | |
| DNA Repair | |
| 8846 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion