missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | ABH1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18442152
|
Novus Biologicals
NBP2-14283-25ul |
25ul |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18195690
|
Novus Biologicals
NBP2-14283 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABH1 Polyclonal specifically detects ABH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ABH1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13686 | |
| 8846 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 44 kDa |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABH1, ABHalkB, alkylation repair homolog (E. coli), alkB, alkB, alkylation repair homolog 1 (E. coli), ALKBH, alkylated DNA repair protein alkB homolog 1, alkylation repair, alkB homolog, Alpha-ketoglutarate-dependent dioxygenase ABH1, DNA lyase ABH1, EC 1.14.11.-, EC 4.2.99.18, hABH | |
| ALKBH1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title