missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACOT11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58936
This item is not returnable.
View return policy
Description
ACOT11 Polyclonal specifically detects ACOT11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ACOT11 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Acyl-CoA thioester hydrolase 11, acyl-CoA thioesterase 11BFIT1, Adipose-associated thioesterase, BFIT2, BFITDKFZp667O1916, Brown fat-inducible thioesterase, EC 3.1.2.-, EC 3.1.2.1, KIAA0707acyl-coenzyme A thioesterase 11, STARD14, START domain containing 14, THEAStAR-related lipid transfer (START) domain containing 14, THEM1, thioesterase superfamily member 1, thioesterase, adipose associated | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ACOT11 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE | |
| 100 μL | |
| Signal Transduction | |
| 26027 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction