missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACOT11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 589.00
Specifications
| Antigen | ACOT11 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18222895
|
Novus Biologicals
NBP2-58936 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18662517
|
Novus Biologicals
NBP2-58936-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACOT11 Polyclonal specifically detects ACOT11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ACOT11 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Acyl-CoA thioester hydrolase 11, acyl-CoA thioesterase 11BFIT1, Adipose-associated thioesterase, BFIT2, BFITDKFZp667O1916, Brown fat-inducible thioesterase, EC 3.1.2.-, EC 3.1.2.1, KIAA0707acyl-coenzyme A thioesterase 11, STARD14, START domain containing 14, THEAStAR-related lipid transfer (START) domain containing 14, THEM1, thioesterase superfamily member 1, thioesterase, adipose associated | |
| ACOT11 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 26027 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title