missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACOT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62632
This item is not returnable.
View return policy
Description
ACOT2 Polyclonal antibody specifically detects ACOT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ACOT2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| acyl-CoA thioesterase 2MTE1, Acyl-coenzyme A thioester hydrolase 2a, acyl-coenzyme A thioesterase 2, mitochondrial, CTE-Ia, EC 3.1.2.2, Long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, mitochondrial acyl-CoA thioesterase 2, peroxisomal long-chain acyl-coA thioesterase 2, PTE2A, PTE2CTE1A, ZAP128Mte1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR | |
| 100 μg | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 10965 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction