missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTSL-1/Punctin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-21377-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ADAMTSL-1/Punctin Polyclonal antibody specifically detects ADAMTSL-1/Punctin in Human samples. It is validated for Immunofluorescence
Spezifikation
| ADAMTSL-1/Punctin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| ADAM-TS related protein 1, ADAMTSL-1, ADAMTS-like 1, ADAMTS-like protein 1, ADAMTSR1MGC118805, C9orf94, chromosome 9 open reading frame 94, DKFZp686L03130, FLJ35283, FLJ41032, FLJ46891, MGC118803, MGC40193, PUNCTIN, Punctin-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: REHFVIKLIGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSRYDDLVSRLL | |
| 25 μg | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 92949 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur