missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTSL-1/Punctin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 450.00 - € 708.00
Specifications
| Antigen | ADAMTSL-1/Punctin |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643245
|
Novus Biologicals
NBP3-21377-100ul |
100 μg |
€ 708.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669853
|
Novus Biologicals
NBP3-21377-25ul |
25 μg |
€ 450.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ADAMTSL-1/Punctin Polyclonal antibody specifically detects ADAMTSL-1/Punctin in Human samples. It is validated for ImmunofluorescenceSpecifications
| ADAMTSL-1/Punctin | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 92949 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ADAM-TS related protein 1, ADAMTSL-1, ADAMTS-like 1, ADAMTS-like protein 1, ADAMTSR1MGC118805, C9orf94, chromosome 9 open reading frame 94, DKFZp686L03130, FLJ35283, FLJ41032, FLJ46891, MGC118803, MGC40193, PUNCTIN, Punctin-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: REHFVIKLIGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSRYDDLVSRLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title