missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-10 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 463.00
Specifications
| Antigen | Aquaporin-10 |
|---|---|
| Dilution | Western Blot 1:200-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18642641
|
Novus Biologicals
NBP2-92417-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18662681
|
Novus Biologicals
NBP2-92417-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-10 Polyclonal antibody specifically detects Aquaporin-10 in Human, Mouse samples. It is validated for Western BlotSpecifications
| Aquaporin-10 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 89872 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| AQP-10, AQPA_HUMAN, Aquaglyceroporin-10, aquaporin 10, aquaporin-10, Small intestine aquaporin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2). CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title