missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARF6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | ARF6 |
|---|---|
| Dilution | Western Blot 1:50 - 1:200 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18611402
|
Novus Biologicals
NBP2-92776-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624812
|
Novus Biologicals
NBP2-92776-0.1ml |
0.1 mL |
€ 463.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARF6 Polyclonal antibody specifically detects ARF6 in Human, Rat samples. It is validated for Western BlotSpecifications
| ARF6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 382 | |
| IgG | |
| Affinity purified |
| Western Blot 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| ADP-ribosylation factor 6, DKFZp564M0264 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 76-175 of human ARF6 (NP_001654.1). HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title