missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATG9A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32477
This item is not returnable.
View return policy
Description
ATG9A Polyclonal specifically detects ATG9A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ATG9A | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| APG9 autophagy 9-like 1, APG9 autophagy 9-like 1 (S. cerevisiae), APG9L1APG9-like 1, ATG9 autophagy related 9 homolog A (S. cerevisiae), autophagy 9-like 1 protein, autophagy-related protein 9A, FLJ22169, mATG9, MGD3208 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATG9A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD | |
| 0.1 mL | |
| Autophagy, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Tumor Suppressors, Ubiquitin Proteasome Pathway | |
| 79065 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction