missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATG9A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 426.00 - € 589.00
Specifications
| Antigen | ATG9A |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18468451
|
Novus Biologicals
NBP2-32477-25ul |
25 μL |
€ 426.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18139094
|
Novus Biologicals
NBP2-32477 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATG9A Polyclonal specifically detects ATG9A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ATG9A | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| APG9 autophagy 9-like 1, APG9 autophagy 9-like 1 (S. cerevisiae), APG9L1APG9-like 1, ATG9 autophagy related 9 homolog A (S. cerevisiae), autophagy 9-like 1 protein, autophagy-related protein 9A, FLJ22169, mATG9, MGD3208 | |
| ATG9A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Tumor Suppressors, Ubiquitin Proteasome Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79065 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title