missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1G1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55232-25ul
This item is not returnable.
View return policy
Description
ATP6V1G1 Polyclonal specifically detects ATP6V1G1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| ATP6V1G1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| ATP6G1V-ATPase 13 kDa subunit 1, ATP6GATP6J, ATP6GL, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 1, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1, DKFZp547P234, vacuolar ATP synthase subunit M16, vacuolar H(+)-ATPase subunit G 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16, V-ATPase subunit G 1, Vma10, V-type proton ATPase subunit G 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9550 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATP6V1G1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering