missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1G1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | ATP6V1G1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18281105
|
Novus Biologicals
NBP2-55232 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671208
|
Novus Biologicals
NBP2-55232-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATP6V1G1 Polyclonal specifically detects ATP6V1G1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| ATP6V1G1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9550 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| ATP6G1V-ATPase 13 kDa subunit 1, ATP6GATP6J, ATP6GL, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 1, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1, DKFZp547P234, vacuolar ATP synthase subunit M16, vacuolar H(+)-ATPase subunit G 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16, V-ATPase subunit G 1, Vma10, V-type proton ATPase subunit G 1 | |
| ATP6V1G1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title