missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B7-2/CD86 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21245-100ul
This item is not returnable.
View return policy
Description
B7-2/CD86 Polyclonal antibody specifically detects B7-2/CD86 in Human samples. It is validated for Immunofluorescence
Specifications
| B7-2/CD86 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GTNTMEREESEQTKKREKIHIPERSDEAQRV | |
| 100 μg | |
| Adaptive Immunity, B Cell Development and Differentiation Markers, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology, Inflammation, Myeloid derived Suppressor Cell, Signal Transduction | |
| 942 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction