missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B7-2/CD86 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 329.00 - € 516.00
Specifications
| Antigen | B7-2/CD86 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18691444
|
Novus Biologicals
NBP3-21245-25ul |
25 μg |
€ 329.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18652065
|
Novus Biologicals
NBP3-21245-100ul |
100 μg |
€ 516.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
B7-2/CD86 Polyclonal antibody specifically detects B7-2/CD86 in Human samples. It is validated for ImmunofluorescenceSpecifications
| B7-2/CD86 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, B Cell Development and Differentiation Markers, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology, Inflammation, Myeloid derived Suppressor Cell, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 942 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GTNTMEREESEQTKKREKIHIPERSDEAQRV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title