missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRD7 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92408-0.02ml
This item is not returnable.
View return policy
Description
BRD7 Polyclonal antibody specifically detects BRD7 in Human samples. It is validated for Western Blot, Gene Knock-Out
Specifications
| BRD7 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| 75 kDa bromodomain protein, BP75bromodomain-containing 7, bromodomain containing 7, bromodomain-containing protein 7, CELTIX1NAG4, Protein CELTIX-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD | |
| 0.02 mL | |
| Cell Biology, Cell Cycle and Replication | |
| 29117 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction