missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRD7 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 474.00
Specifications
| Antigen | BRD7 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Knockout Validated |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637011
|
Novus Biologicals
NBP2-92408-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663511
|
Novus Biologicals
NBP2-92408-0.1ml |
0.1 mL |
€ 474.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BRD7 Polyclonal antibody specifically detects BRD7 in Human samples. It is validated for Western Blot, Gene Knock-OutSpecifications
| BRD7 | |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication | |
| PBS with 50% glycerol, pH7.3. | |
| 29117 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 75 kDa bromodomain protein, BP75bromodomain-containing 7, bromodomain containing 7, bromodomain-containing protein 7, CELTIX1NAG4, Protein CELTIX-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title