missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBX1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92768-0.1ml
This item is not returnable.
View return policy
Description
CBX1 Polyclonal antibody specifically detects CBX1 in Human samples. It is validated for Western Blot
Specifications
| CBX1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| CBXM31HP1-BETA, chromobox homolog 1, chromobox homolog 1 (Drosophila HP1 beta), chromobox homolog 1 (HP1 beta homolog Drosophila ), chromobox protein homolog 1, Heterochromatin protein 1 homolog beta, heterochromatin protein 1-beta, Heterochromatin protein p25, heterochromatin protein p25 beta, HP1 beta, HP1 beta homolog, HP1Hsbeta, HP1Hs-beta, MOD1, Modifier 1 protein, p25beta | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1). MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP | |
| 0.1 mL | |
| Chromatin Research | |
| 10951 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction