missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBX1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | CBX1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18652552
|
Novus Biologicals
NBP2-92768-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633732
|
Novus Biologicals
NBP2-92768-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CBX1 Polyclonal antibody specifically detects CBX1 in Human samples. It is validated for Western BlotSpecifications
| CBX1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Chromatin Research | |
| PBS with 50% glycerol, pH7.3. | |
| 10951 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CBXM31HP1-BETA, chromobox homolog 1, chromobox homolog 1 (Drosophila HP1 beta), chromobox homolog 1 (HP1 beta homolog Drosophila ), chromobox protein homolog 1, Heterochromatin protein 1 homolog beta, heterochromatin protein 1-beta, Heterochromatin protein p25, heterochromatin protein p25 beta, HP1 beta, HP1 beta homolog, HP1Hsbeta, HP1Hs-beta, MOD1, Modifier 1 protein, p25beta | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1). MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title