missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD30/TNFRSF8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38201
This item is not returnable.
View return policy
Description
CD30/TNFRSF8 Polyclonal specifically detects CD30/TNFRSF8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CD30/TNFRSF8 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CD30, CD30 antigen, CD30KI-1, CD30L receptor, cytokine receptor CD30, D1S166EKi-1, Ki-1 antigen, Lymphocyte activation antigen CD30, tumor necrosis factor receptor superfamily member 8, tumor necrosis factor receptor superfamily, member 8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TNFRSF8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS | |
| 0.1 mL | |
| Apoptosis, Cell Cycle and Replication, Embryonic Stem Cell Markers, Immunology, Stem Cell Markers | |
| 943 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction