missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD30/TNFRSF8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 456.00
Specifications
| Antigen | CD30/TNFRSF8 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18129838
|
Novus Biologicals
NBP2-38201 |
0.1 mL |
€ 456.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653756
|
Novus Biologicals
NBP2-38201-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD30/TNFRSF8 Polyclonal specifically detects CD30/TNFRSF8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD30/TNFRSF8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD30, CD30 antigen, CD30KI-1, CD30L receptor, cytokine receptor CD30, D1S166EKi-1, Ki-1 antigen, Lymphocyte activation antigen CD30, tumor necrosis factor receptor superfamily member 8, tumor necrosis factor receptor superfamily, member 8 | |
| TNFRSF8 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cell Cycle and Replication, Embryonic Stem Cell Markers, Immunology, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 943 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title