missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD8 Antibody (CL1529), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-36743
This item is not returnable.
View return policy
Description
CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CD8 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD8, CD8a molecule, LEU2, p32 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL1529 | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin | |
| P01732 | |
| CD8A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT | |
| 0.1 mL | |
| Innate Immunity | |
| 925 | |
| Protein A purified | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction