missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdk5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38178-100ul
This item is not returnable.
View return policy
Description
Cdk5 Polyclonal antibody specifically detects Cdk5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Cdk5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells | |
| Cell division protein kinase 5, cyclin-dependent kinase 5, EC 2.7.11, EC 2.7.11.22, protein kinase CDK5 splicing, PSSALRE, Serine/threonine-protein kinase PSSALRE, Tau protein kinase II catalytic subunit, TPKII catalytic subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human Cdk5 (NP_004926.1).,, Sequence:, PDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF | |
| 100 μL | |
| Cell Cycle and Replication, Innate Immunity, Phospho Specific | |
| 1020 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction