missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdk5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 724.00
Specifications
| Antigen | Cdk5 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells |
| Applications | ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232215
|
Novus Biologicals
NBP3-38178-100ul |
100 μL |
€ 724.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230550
|
Novus Biologicals
NBP3-38178-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdk5 Polyclonal antibody specifically detects Cdk5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| Cdk5 | |
| ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Innate Immunity, Phospho Specific | |
| PBS (pH 7.3), 50% glycerol | |
| 1020 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Cell division protein kinase 5, cyclin-dependent kinase 5, EC 2.7.11, EC 2.7.11.22, protein kinase CDK5 splicing, PSSALRE, Serine/threonine-protein kinase PSSALRE, Tau protein kinase II catalytic subunit, TPKII catalytic subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human Cdk5 (NP_004926.1).,, Sequence:, PDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title