missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ChemR23/CMKLR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13847
This item is not returnable.
View return policy
Description
ChemR23/CMKLR1 Polyclonal antibody specifically detects ChemR23/CMKLR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ChemR23/CMKLR1 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CHEMERINR, chemokine receptor-like 1, chemokine-like receptor 1, CHEMR23, DEZ, G-protein coupled receptor ChemR23, G-protein coupled receptor DEZ, MGC126105, MGC126106, orphan G-protein coupled receptor, Dez | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG | |
| 0.1 mL | |
| GPCR, Immunology | |
| 1240 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction