missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ChemR23/CMKLR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 574.00
Specifications
| Antigen | ChemR23/CMKLR1 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18474612
|
Novus Biologicals
NBP2-13847-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18457761
|
Novus Biologicals
NBP2-13847 |
0.1 mL |
€ 574.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ChemR23/CMKLR1 Polyclonal antibody specifically detects ChemR23/CMKLR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ChemR23/CMKLR1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| GPCR, Immunology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1240 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CHEMERINR, chemokine receptor-like 1, chemokine-like receptor 1, CHEMR23, DEZ, G-protein coupled receptor ChemR23, G-protein coupled receptor DEZ, MGC126105, MGC126106, orphan G-protein coupled receptor, Dez | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title