missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIDEB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92347-0.1ml
This item is not returnable.
View return policy
Description
CIDEB Polyclonal antibody specifically detects CIDEB in Human samples. It is validated for Western Blot
Specifications
| CIDEB | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000 | |
| cell death-inducing DFFA-like effector bcell death activator CIDE-B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human CIDEB (NP_001305736). DGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLY | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication | |
| 27141 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction