missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIDEB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 463.00
Specifications
| Antigen | CIDEB |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18665541
|
Novus Biologicals
NBP2-92347-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608060
|
Novus Biologicals
NBP2-92347-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CIDEB Polyclonal antibody specifically detects CIDEB in Human samples. It is validated for Western BlotSpecifications
| CIDEB | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication | |
| PBS with 50% glycerol, pH7.3. | |
| 27141 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| cell death-inducing DFFA-like effector bcell death activator CIDE-B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human CIDEB (NP_001305736). DGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title