missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | COX18 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18462592
|
Novus Biologicals
NBP2-30593-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18140995
|
Novus Biologicals
NBP2-30593 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
COX18 Polyclonal specifically detects COX18 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| COX18 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| COX18 cytochrome c oxidase assembly homolog (S. cerevisiae), COX18HS, Cox18Hs1 protein, Cox18Hs2 protein, Cox18Hs3 protein, Cytochrome c oxidase assembly protein 18, FLJ38991, MGC126733, mitochondrial COX18, mitochondrial inner membrane protein COX18, OXA1L2 | |
| COX18 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N8Q8 | |
| 285521 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNC | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel