missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytokeratin 5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92884-0.02ml
This item is not returnable.
View return policy
Description
Cytokeratin 5 Polyclonal antibody specifically detects Cytokeratin 5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
| Cytokeratin 5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:2000 - 1:6000, Immunohistochemistry-Paraffin | |
| 58 kDa cytokeratin, CK5, CK-5, cytokeratin-5, DDD, EBS2, epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types, K5, keratin 5, keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockaynetypes), keratin, type II cytoskeletal 5, Keratin-5, KRT5A, Type-II keratin Kb5 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (NP_000415.2). MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG | |
| 0.02 mL | |
| Cell Biology, Cellular Markers | |
| 3852 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction