missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytokeratin 5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 216.00 - € 498.00
Specifications
| Antigen | Cytokeratin 5 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:2000 - 1:6000, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666702
|
Novus Biologicals
NBP2-92884-0.02ml |
0.02 mL |
€ 216.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634852
|
Novus Biologicals
NBP2-92884-0.1ml |
0.1 mL |
€ 498.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cytokeratin 5 Polyclonal antibody specifically detects Cytokeratin 5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)Specifications
| Cytokeratin 5 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 3852 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:2000 - 1:6000, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| 58 kDa cytokeratin, CK5, CK-5, cytokeratin-5, DDD, EBS2, epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types, K5, keratin 5, keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockaynetypes), keratin, type II cytoskeletal 5, Keratin-5, KRT5A, Type-II keratin Kb5 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (NP_000415.2). MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title