missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92233-0.1ml
This item is not returnable.
View return policy
Description
Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Cytosolic Sulfotransferase 1C4/SULT1C4 | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2). MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS | |
| 0.1 mL | |
| Cancer, Cell Biology, Endocrinology, Signal Transduction | |
| 27233 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction