missing translation for 'onlineSavingsMsg'
Learn More

DDX6 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Novus Biologicals NBP3-33553-20ul

View more versions of this product

Product Code. 30232232

€ 213.00 / 20µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DDX6 Monoclonal antibody specifically detects DDX6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

Antigen	DDX6
Classification	Monoclonal
Dilution	Western Blot 1:500 - 1:2000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Gene Alias	ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD box protein 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), EC 3.6.1, EC 3.6.4.13, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196).,, Sequence:, YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT
Quantity	20 μL
Research Discipline	Cancer, Tumor Suppressors
Gene ID (Entrez)	1656
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DDX6 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions