missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Rat, Clone: 1Q5F6, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-16444-100UL
This item is not returnable.
View return policy
Description
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Monoclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human, Rat samples. It is validated for Western Blot
Specifications
| Dimethylarginine Dimethylaminohydrolase 1/DDAH1 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Western Blot | |
| 1Q5F6 | |
| Western Blot 1:500 - 1:2000 | |
| DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase | |
| A synthetic peptide corresponding to a sequence within amino acids 186-285 of human Dimethylarginine Dimethylaminohydrolase 1/DDAH1 (O94760). IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS | |
| 100 μg | |
| Signal Transduction | |
| 23576 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction