missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DOG1/TMEM16A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76552
This item is not returnable.
View return policy
Description
DOG1/TMEM16A Polyclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DOG1/TMEM16A | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A | |
| Rabbit | |
| 100 μL | |
| 55107 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| ANO1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MVEVFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction