missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DOG1/TMEM16A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 599.00
Specifications
| Antigen | DOG1/TMEM16A |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18684360
|
Novus Biologicals
NBP2-76552-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18258458
|
Novus Biologicals
NBP2-76552 |
100 μL |
€ 599.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DOG1/TMEM16A Polyclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DOG1/TMEM16A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Human | |
| ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A | |
| ANO1 | |
| IgG | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 55107 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MVEVFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title