missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DP2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92440-0.1ml
This item is not returnable.
View return policy
Description
DP2 Polyclonal antibody specifically detects DP2 in Mouse samples. It is validated for Western Blot
Specifications
| DP2 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| DKFZp313O196, DP2Dp-2, E2F dimerization partner 2, FLJ39131, transcription factor Dp-2, transcription factor Dp-2 (E2F dimerization partner 2) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1). GYITDISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDEEDDEEDSSSPE | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 7029 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction