missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DP2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 462.00
Specifications
| Antigen | DP2 |
|---|---|
| Dilution | Western Blot 1:200-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DP2 Polyclonal antibody specifically detects DP2 in Mouse samples. It is validated for Western BlotSpecifications
| DP2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS with 50% glycerol, pH7.3. | |
| 7029 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| DKFZp313O196, DP2Dp-2, E2F dimerization partner 2, FLJ39131, transcription factor Dp-2, transcription factor Dp-2 (E2F dimerization partner 2) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1). GYITDISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDEEDDEEDSSSPE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title