missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E6AP/UBE3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89092-25ul
This item is not returnable.
View return policy
Description
E6AP/UBE3A Polyclonal antibody specifically detects E6AP/UBE3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifications
| E6AP/UBE3A | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ANCREPVE6AP, AS, CTCL tumor antigen se37-2, E6AP, E6-AP, E6AP ubiquitin-protein ligase, EC 6.3.2.-, FLJ26981, HPVE6A, human papilloma virus E6-associated protein, Human papillomavirus E6-associated protein, Oncogenic protein-associated protein E6-AP, Renal carcinoma antigen NY-REN-54, ubiquitin protein ligase E3A, ubiquitin-protein ligase E3A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human E6AP/UBE3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| UBE3A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK | |
| 25 μL | |
| Apoptosis, Transcription Factors and Regulators | |
| 7337 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction