missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E6AP/UBE3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 549.00
Specifications
| Antigen | E6AP/UBE3A |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18453651
|
Novus Biologicals
NBP1-89092-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18700564
|
Novus Biologicals
NBP1-89092 |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
E6AP/UBE3A Polyclonal antibody specifically detects E6AP/UBE3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| E6AP/UBE3A | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| ANCREPVE6AP, AS, CTCL tumor antigen se37-2, E6AP, E6-AP, E6AP ubiquitin-protein ligase, EC 6.3.2.-, FLJ26981, HPVE6A, human papilloma virus E6-associated protein, Human papillomavirus E6-associated protein, Oncogenic protein-associated protein E6-AP, Renal carcinoma antigen NY-REN-54, ubiquitin protein ligase E3A, ubiquitin-protein ligase E3A | |
| UBE3A | |
| IgG | |
| Affinity Purified | |
| Specificity of human E6AP/UBE3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7337 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title