missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92419-0.1ml
This item is not returnable.
View return policy
Description
EAAT4 Polyclonal antibody specifically detects EAAT4 in Human, Mouse samples. It is validated for Western Blot
Specifications
| EAAT4 | |
| Polyclonal | |
| Western Blot 1:500-1:1000 | |
| EAAT4MGC43671, excitatory amino acid transporter 4, MGC33092, Sodium-dependent glutamate/aspartate transporter, solute carrier family 1 (high affinity aspartate/glutamate transporter), member6, Solute carrier family 1 member 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1). PGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANG | |
| 0.1 mL | |
| Neuroscience | |
| 6511 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction