missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 463.00
Specifications
| Antigen | EAAT4 |
|---|---|
| Dilution | Western Blot 1:500-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609900
|
Novus Biologicals
NBP2-92419-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633440
|
Novus Biologicals
NBP2-92419-0.1ml |
0.1 mL |
€ 463.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EAAT4 Polyclonal antibody specifically detects EAAT4 in Human, Mouse samples. It is validated for Western BlotSpécification
| EAAT4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS with 50% glycerol, pH7.3. | |
| 6511 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EAAT4MGC43671, excitatory amino acid transporter 4, MGC33092, Sodium-dependent glutamate/aspartate transporter, solute carrier family 1 (high affinity aspartate/glutamate transporter), member6, Solute carrier family 1 member 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1). PGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit